Lineage for d1d7al_ (1d7a L:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21773Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
  4. 22095Superfamily c.23.8: N5-carboxyaminoimidazole ribonucleotide (N5-CAIR) mutase PurE [52255] (1 family) (S)
  5. 22096Family c.23.8.1: N5-carboxyaminoimidazole ribonucleotide (N5-CAIR) mutase PurE [52256] (1 protein)
  6. 22097Protein N5-carboxyaminoimidazole ribonucleotide (N5-CAIR) mutase PurE [52257] (1 species)
  7. 22098Species Escherichia coli [TaxId:562] [52258] (2 PDB entries)
  8. 22104Domain d1d7al_: 1d7a L: [31281]

Details for d1d7al_

PDB Entry: 1d7a (more details), 2.5 Å

PDB Description: crystal structure of e. coli pure-mononucleotide complex.

SCOP Domain Sequences for d1d7al_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d7al_ c.23.8.1 (L:) N5-carboxyaminoimidazole ribonucleotide (N5-CAIR) mutase PurE {Escherichia coli}
garvaivmgsksdwatmqfaaeifeilnvphhvevvsahrtpdklfsfaesaeengyqvi
iagaggaahlpgmiaaktlvpvlgvpvqsaalsgvdslysivqmprgipvgtlaigkaga
anaallaaqilathdkelhqrlndwrkaqtdevlenpdprg

SCOP Domain Coordinates for d1d7al_:

Click to download the PDB-style file with coordinates for d1d7al_.
(The format of our PDB-style files is described here.)

Timeline for d1d7al_: