Lineage for d5arjc1 (5arj C:1-119)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2174483Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 2174484Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 2174485Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 2174918Protein automated matches [190061] (7 species)
    not a true protein
  7. 2175071Species Sus scrofa [TaxId:9823] [312520] (3 PDB entries)
  8. 2175082Domain d5arjc1: 5arj C:1-119 [312805]
    Other proteins in same PDB: d5arja2, d5arjc2, d5arjd2
    automated match to d2rnfa_
    mutant

Details for d5arjc1

PDB Entry: 5arj (more details), 2.9 Å

PDB Description: crystal structure of porcine rnase 4 d80a mutant
PDB Compounds: (C:) ribonuclease 4

SCOPe Domain Sequences for d5arjc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5arjc1 d.5.1.1 (C:1-119) automated matches {Sus scrofa [TaxId: 9823]}
qdrmyqrflrqhvdpdatggndaycnlmmqrrkmtshyckrfntfihediwnirsicsts
niqckngqmnchegvvkvtacretgssrapncryramastrrvviacegnpevpvhfdk

SCOPe Domain Coordinates for d5arjc1:

Click to download the PDB-style file with coordinates for d5arjc1.
(The format of our PDB-style files is described here.)

Timeline for d5arjc1: