Lineage for d5cgee1 (5cge E:1-263)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2904325Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2904326Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2904617Family c.72.1.0: automated matches [191321] (1 protein)
    not a true family
  6. 2904618Protein automated matches [190117] (50 species)
    not a true protein
  7. 2904899Species Staphylococcus aureus [TaxId:282458] [312718] (3 PDB entries)
  8. 2904904Domain d5cgee1: 5cge E:1-263 [312793]
    Other proteins in same PDB: d5cgea2, d5cgee2
    automated match to d3hpda_
    complexed with 51f, mg

Details for d5cgee1

PDB Entry: 5cge (more details), 1.62 Å

PDB Description: structure of hydroxyethylthiazole kinase thim from staphylococcus aureus in complex with substrate analog 2-(2-methyl-1h-imidazole-1- yl)ethanol
PDB Compounds: (E:) hydroxyethylthiazole kinase

SCOPe Domain Sequences for d5cgee1:

Sequence, based on SEQRES records: (download)

>d5cgee1 c.72.1.0 (E:1-263) automated matches {Staphylococcus aureus [TaxId: 282458]}
mnylnnirienplticytndvvknftangllsigaspamseapeeaeefykvaqallini
gtltaqneqdiiaiaqtaneaglpivfdpvavgastyrkqfcklllksakvsvikgnase
ilaliddtatmkgtdsdanldavtiakkayaiyktaivitgkedvivqgdkaivlangsp
llarvtgagcllggiiagflfretepdiealieavsvfniaaevaaenencggpgtfspl
lldtlyhlnettyqqririqeve

Sequence, based on observed residues (ATOM records): (download)

>d5cgee1 c.72.1.0 (E:1-263) automated matches {Staphylococcus aureus [TaxId: 282458]}
mnylnnirienplticytndvvknftangllsigaspamseapeeaeefykvaqallini
gtltaqneqdiiaiaqtaneaglpivfdpvavgastyrkqfcklllksakvsvikgnase
ilaliddtatmkgtdsnldavtiakkayaiyktaivitgkedvivqgdkaivlangspll
arvtgagcllggiiagflfretepdiealieavsvfniaaevaaenencggpgtfsplll
dtlyhlnettyqqririqeve

SCOPe Domain Coordinates for d5cgee1:

Click to download the PDB-style file with coordinates for d5cgee1.
(The format of our PDB-style files is described here.)

Timeline for d5cgee1: