Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
Superfamily c.72.1: Ribokinase-like [53613] (6 families) has extra strand located between strands 2 and 3 |
Family c.72.1.0: automated matches [191321] (1 protein) not a true family |
Protein automated matches [190117] (50 species) not a true protein |
Species Staphylococcus aureus [TaxId:282458] [312718] (3 PDB entries) |
Domain d5cgee1: 5cge E:1-263 [312793] Other proteins in same PDB: d5cgea2, d5cgee2 automated match to d3hpda_ complexed with 51f, mg |
PDB Entry: 5cge (more details), 1.62 Å
SCOPe Domain Sequences for d5cgee1:
Sequence, based on SEQRES records: (download)
>d5cgee1 c.72.1.0 (E:1-263) automated matches {Staphylococcus aureus [TaxId: 282458]} mnylnnirienplticytndvvknftangllsigaspamseapeeaeefykvaqallini gtltaqneqdiiaiaqtaneaglpivfdpvavgastyrkqfcklllksakvsvikgnase ilaliddtatmkgtdsdanldavtiakkayaiyktaivitgkedvivqgdkaivlangsp llarvtgagcllggiiagflfretepdiealieavsvfniaaevaaenencggpgtfspl lldtlyhlnettyqqririqeve
>d5cgee1 c.72.1.0 (E:1-263) automated matches {Staphylococcus aureus [TaxId: 282458]} mnylnnirienplticytndvvknftangllsigaspamseapeeaeefykvaqallini gtltaqneqdiiaiaqtaneaglpivfdpvavgastyrkqfcklllksakvsvikgnase ilaliddtatmkgtdsnldavtiakkayaiyktaivitgkedvivqgdkaivlangspll arvtgagcllggiiagflfretepdiealieavsvfniaaevaaenencggpgtfsplll dtlyhlnettyqqririqeve
Timeline for d5cgee1: