Lineage for d5bv5d_ (5bv5 D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2330959Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2330960Protein Cyp119 [48278] (3 species)
    thermophilic P450
  7. 2330967Species Sulfolobus solfataricus [TaxId:2287] [48279] (6 PDB entries)
  8. 2330978Domain d5bv5d_: 5bv5 D: [312787]
    automated match to d1f4ta_
    complexed with hem, pim, po4; mutant

Details for d5bv5d_

PDB Entry: 5bv5 (more details), 2.7 Å

PDB Description: structure of cyp119 with t213a and c317h mutations
PDB Compounds: (D:) cytochrome p450 119

SCOPe Domain Sequences for d5bv5d_:

Sequence, based on SEQRES records: (download)

>d5bv5d_ a.104.1.1 (D:) Cyp119 {Sulfolobus solfataricus [TaxId: 2287]}
mydwfsemrkkdpvyydgniwqvfsyrytkevlnnfskfssdltgyherledlrngkirf
diptrytmltsdpplhdelrsmsadifspqklqtletfirettrslldsidpreddivkk
lavplpiiviskilglpiedkekfkewsdlvafrlgkpgeifelgkkyleligyvkdhln
sgtevvsrvvnsnlsdieklgyiillliagneattnlisnsvidftrfnlwqrireenly
lkaieealrysppvmrtvrktkervklgdqtieegeyvrvwiasanrdeevfhdgekfip
drnpnphlsfgsgihlhlgaplarleariaieefskrfrhieildtekvpnevlngykrl
vvrlks

Sequence, based on observed residues (ATOM records): (download)

>d5bv5d_ a.104.1.1 (D:) Cyp119 {Sulfolobus solfataricus [TaxId: 2287]}
mydwfsemrkkdpvyydgniwqvfsyrytkevlnnfskfssdpplhdelrsmsadifspq
klqtletfirettrslldsidpreddivkklavplpiiviskilglpiedkekfkewsdl
vafifelgkkyleligyvkdhlnsgtevvsrvvsnlsdieklgyiillliagneattnli
snsvidftrfnlwqrireenlylkaieealrysppvmrtvrktkervkldqtieegeyvr
vwiasanrdeevfhdgekfipdrnpnphlsfgsgihlhlgaplarleariaieefskrfr
hieildtekvpnevlngykrlvvrlks

SCOPe Domain Coordinates for d5bv5d_:

Click to download the PDB-style file with coordinates for d5bv5d_.
(The format of our PDB-style files is described here.)

Timeline for d5bv5d_: