SCOPe 2.08: Domain d5ckfa_: 5ckf A:

Lineage for d5ckfa_ (5ckf A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.6: Cell growth inhibitor/plasmid maintenance toxic component [50118] (4 families)
   contains insert beta-sheet subdomain and C-terminal helix

5. Family b.34.6.2: Kid/PemK [82075] (4 proteins)
   automatically mapped to Pfam PF02452

6. Protein automated matches [228538] (6 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [312759] (6 PDB entries)

8. Domain d5ckfa_: 5ckf A: [312786]
   Other proteins in same PDB: d5ckfb2
   automated match to d1ub4a_
   complexed with na

Details for d5ckfa_

PDB Entry: 5ckf, 2.8 Å

PDB Description: e. coli mazf e24a form i

PDB Compounds: (A:) Endoribonuclease MazF

SCOPe Domain Sequences for d5ckfa_:

Sequence, based on SEQRES records:

>d5ckfa_ b.34.6.2 (A:) automated matches {Escherichia coli [TaxId: 83333]}
vsryvpdmgdliwvdfdptkgsaqaghrpavvlspfmynnktgmclcvpcttqskgypfe
vvlsgqerdgvaladqvksiawrargatkkgtvapeelqlikakinvlig

Sequence, based on observed residues (ATOM records):

>d5ckfa_ b.34.6.2 (A:) automated matches {Escherichia coli [TaxId: 83333]}
vsryvpdmgdliwvdfqaghrpavvlspfmynnktgmclcvpcttqskgypfevvlsgqe
rdgvaladqvksiawrargatkkgtvapeelqlikakinvlig

Timeline for d5ckfa_:

• d5ckfa_ first appeared in SCOPe 2.06
  
• d5ckfa_ appears in SCOPe 2.07