SCOPe 2.08: Domain d5cmta1: 5cmt A:11-189

Lineage for d5cmta1 (5cmt A:11-189)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.265: Fic-like [140930] (1 superfamily)
   multihelical; one central helix is surrounded by seven helices

4. Superfamily a.265.1: Fic-like [140931] (1 family)

5. Family a.265.1.1: Fic-like [140932] (3 proteins)
   Pfam PF02661; the conserved motif HPFXXGNG is at the N-terminus of the central helix

6. Protein automated matches [191277] (4 species)
   not a true protein

7. Species Neisseria meningitidis [TaxId:491] [189879] (5 PDB entries)

8. Domain d5cmta1: 5cmt A:11-189 [312782]
   Other proteins in same PDB: d5cmta2
   automated match to d3s6aa_
   complexed with cl, gol; mutant

Details for d5cmta1

PDB Entry: 5cmt, 0.99 Å

PDB Description: fic protein from neisseria meningitidis (nmfic) mutant e156r y183f in dimeric form

PDB Compounds: (A:) adenosine monophosphate-protein transferase nmfic

SCOPe Domain Sequences for d5cmta1:

Sequence; same for both SEQRES and ATOM records:

>d5cmta1 a.265.1.1 (A:11-189) automated matches {Neisseria meningitidis [TaxId: 491]}
mksideqslhnarrlfesgdidrievgttaglqqihrylfgglydfagqiredniskggf
rfanamylkealvkieqmpertfeeiiakyvemniahpflegngrstriwldlvlkknlk
kvvnwqnvsktlylqamerspvndlrlrfllkdnltddvdnreiifkgieqsfyyegye

Timeline for d5cmta1:

• d5cmta1 first appeared in SCOPe 2.06
  
• d5cmta1 appears in SCOPe 2.07