Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.1: Class I aldolase [51570] (13 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
Protein automated matches [190095] (28 species) not a true protein |
Species Colwellia psychrerythraea [TaxId:167879] [312672] (1 PDB entry) |
Domain d5c5ya_: 5c5y A: [312775] automated match to d1p1xa_ complexed with gol, unl |
PDB Entry: 5c5y (more details), 2.1 Å
SCOPe Domain Sequences for d5c5ya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5c5ya_ c.1.10.1 (A:) automated matches {Colwellia psychrerythraea [TaxId: 167879]} sdikavaqralslmdltsltntetdqeiidlcrqakspagetaaicifprfipvakkalk aqqtphikiatvtnfpqgnddldialaetraavaygadevdlvfpyraliqgnetigfdm vkvckqacsgnaklkviietgelkseelirkaseiainagadfiktstgkvainatpeaa kvmltviknkntavgfkpaggvrnaddaaiyldladnilgnewadanhfrfgassllisl ldtlghk
Timeline for d5c5ya_: