Lineage for d5c5ya_ (5c5y A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2834403Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2834988Protein automated matches [190095] (28 species)
    not a true protein
  7. 2835011Species Colwellia psychrerythraea [TaxId:167879] [312672] (1 PDB entry)
  8. 2835012Domain d5c5ya_: 5c5y A: [312775]
    automated match to d1p1xa_
    complexed with gol, unl

Details for d5c5ya_

PDB Entry: 5c5y (more details), 2.1 Å

PDB Description: crystal structure of deoxyribose-phosphate aldolase from colwellia psychrerythraea (hexagonal form)
PDB Compounds: (A:) deoxyribose-phosphate aldolase

SCOPe Domain Sequences for d5c5ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c5ya_ c.1.10.1 (A:) automated matches {Colwellia psychrerythraea [TaxId: 167879]}
sdikavaqralslmdltsltntetdqeiidlcrqakspagetaaicifprfipvakkalk
aqqtphikiatvtnfpqgnddldialaetraavaygadevdlvfpyraliqgnetigfdm
vkvckqacsgnaklkviietgelkseelirkaseiainagadfiktstgkvainatpeaa
kvmltviknkntavgfkpaggvrnaddaaiyldladnilgnewadanhfrfgassllisl
ldtlghk

SCOPe Domain Coordinates for d5c5ya_:

Click to download the PDB-style file with coordinates for d5c5ya_.
(The format of our PDB-style files is described here.)

Timeline for d5c5ya_: