| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.265: Fic-like [140930] (1 superfamily) multihelical; one central helix is surrounded by seven helices |
Superfamily a.265.1: Fic-like [140931] (1 family) ![]() |
| Family a.265.1.1: Fic-like [140932] (3 proteins) Pfam PF02661; the conserved motif HPFXXGNG is at the N-terminus of the central helix |
| Protein automated matches [191277] (4 species) not a true protein |
| Species Neisseria meningitidis [TaxId:122586] [312766] (1 PDB entry) |
| Domain d5ckla1: 5ckl A:11-190 [312767] Other proteins in same PDB: d5ckla2 automated match to d3s6aa_ complexed with cl, gol; mutant |
PDB Entry: 5ckl (more details), 0.99 Å
SCOPe Domain Sequences for d5ckla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ckla1 a.265.1.1 (A:11-190) automated matches {Neisseria meningitidis [TaxId: 122586]}
mksideqslhnarrlfesgdidrievgttaglqqihrylfgglydfagqiredniskggf
rfanamylkealvkieqmpertfeeiiakyvemniahpflegngrstriwldlvlkknlk
kvvnwqnvsktlylqamerspvndlrlrfllkdnltddvdnreiifkgieqsyyyegyek
Timeline for d5ckla1: