SCOPe 2.08: Domain d5ckla1: 5ckl A:11-190

Lineage for d5ckla1 (5ckl A:11-190)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.265: Fic-like [140930] (1 superfamily)
   multihelical; one central helix is surrounded by seven helices

4. Superfamily a.265.1: Fic-like [140931] (1 family)

5. Family a.265.1.1: Fic-like [140932] (3 proteins)
   Pfam PF02661; the conserved motif HPFXXGNG is at the N-terminus of the central helix

6. Protein automated matches [191277] (4 species)
   not a true protein

7. Species Neisseria meningitidis [TaxId:122586] [312766] (1 PDB entry)

8. Domain d5ckla1: 5ckl A:11-190 [312767]
   Other proteins in same PDB: d5ckla2
   automated match to d3s6aa_
   complexed with cl, gol; mutant

Details for d5ckla1

PDB Entry: 5ckl, 0.99 Å

PDB Description: fic protein from neisseria meningitidis (nmfic) mutant e156r in dimeric form

PDB Compounds: (A:) adenosine monophosphate-protein transferase nmfic

SCOPe Domain Sequences for d5ckla1:

Sequence; same for both SEQRES and ATOM records:

>d5ckla1 a.265.1.1 (A:11-190) automated matches {Neisseria meningitidis [TaxId: 122586]}
mksideqslhnarrlfesgdidrievgttaglqqihrylfgglydfagqiredniskggf
rfanamylkealvkieqmpertfeeiiakyvemniahpflegngrstriwldlvlkknlk
kvvnwqnvsktlylqamerspvndlrlrfllkdnltddvdnreiifkgieqsyyyegyek

Timeline for d5ckla1:

• d5ckla1 first appeared in SCOPe 2.06
  
• d5ckla1 appears in SCOPe 2.07