SCOPe 2.08: Domain d5c7tb_: 5c7t B:

Lineage for d5c7tb_ (5c7t B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (8 families)

5. Family d.113.1.0: automated matches [191580] (1 protein)
   not a true family

6. Protein automated matches [191036] (17 species)
   not a true protein

7. Species Bdellovibrio bacteriovorus [TaxId:264462] [312720] (3 PDB entries)

8. Domain d5c7tb_: 5c7t B: [312758]
   automated match to d1vhzb_
   complexed with apr, gol, peg, pg0, pge, so4

Details for d5c7tb_

PDB Entry: 5c7t, 2.06 Å

PDB Description: crystal structure of the bdellovibrio bacteriovorus nucleoside diphosphate sugar hydrolase in complex with adp-ribose

PDB Compounds: (B:) NudF protein

SCOPe Domain Sequences for d5c7tb_:

Sequence; same for both SEQRES and ATOM records:

>d5c7tb_ d.113.1.0 (B:) automated matches {Bdellovibrio bacteriovorus [TaxId: 264462]}
hleektlstrqifkgrylkieqdqvqapdgrtytreyilhpgaammipllpngnvvmihq
yrhavkkvflefpagkrdhneetlltakrelleetgyeakdwkflttihpvigysnehid
lylardlthleqrldqgqfievvevkpadlmqlvlegkvsdvktqigafwldkflrgew

Timeline for d5c7tb_:

• d5c7tb_ first appeared in SCOPe 2.06
  
• d5c7tb_ appears in SCOPe 2.07