![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.79: MerB N-terminal domain-like [158323] (1 protein) |
![]() | Protein Alkylmercury lyase MerB [158324] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [158325] (17 PDB entries) Uniprot P77072 21-80 |
![]() | Domain d5c0ta1: 5c0t A:1-80 [312756] Other proteins in same PDB: d5c0ta2, d5c0tb2 automated match to d3f0pa1 complexed with br, hg; mutant |
PDB Entry: 5c0t (more details), 1.96 Å
SCOPe Domain Sequences for d5c0ta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5c0ta1 a.4.5.79 (A:1-80) Alkylmercury lyase MerB {Escherichia coli [TaxId: 562]} mklapyilelltsvnrtngtadllvpllrelakgrpvsrttlagildwpaervaavleqa tsteydkdgniigygltlre
Timeline for d5c0ta1: