![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (31 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
![]() | Domain d5c9ja2: 5c9j A:188-281 [312753] Other proteins in same PDB: d5c9ja1, d5c9ja3, d5c9jb1, d5c9jb2 automated match to d3s6ca3 complexed with dao, gol, po4, ste |
PDB Entry: 5c9j (more details), 2.4 Å
SCOPe Domain Sequences for d5c9ja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5c9ja2 b.1.1.0 (A:188-281) automated matches {Human (Homo sapiens) [TaxId: 9606]} qvkpeawlssgpspgpgrlqlvchvsgfypkpvwvmwmrgeqeqqgtqlgdilpnanwtw ylratldvadgeaaglscrvkhsslegqdiilyw
Timeline for d5c9ja2: