Lineage for d5c9ja2 (5c9j A:188-281)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2757627Domain d5c9ja2: 5c9j A:188-281 [312753]
    Other proteins in same PDB: d5c9ja1, d5c9ja3, d5c9jb1, d5c9jb2
    automated match to d3s6ca3
    complexed with dao, gol, po4, ste

Details for d5c9ja2

PDB Entry: 5c9j (more details), 2.4 Å

PDB Description: human cd1c with ligands in a' and f' channel
PDB Compounds: (A:) T-cell surface glycoprotein CD1c,T-cell surface glycoprotein CD1b

SCOPe Domain Sequences for d5c9ja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c9ja2 b.1.1.0 (A:188-281) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvkpeawlssgpspgpgrlqlvchvsgfypkpvwvmwmrgeqeqqgtqlgdilpnanwtw
ylratldvadgeaaglscrvkhsslegqdiilyw

SCOPe Domain Coordinates for d5c9ja2:

Click to download the PDB-style file with coordinates for d5c9ja2.
(The format of our PDB-style files is described here.)

Timeline for d5c9ja2: