Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) |
Family d.142.1.0: automated matches [227184] (1 protein) not a true family |
Protein automated matches [226904] (38 species) not a true protein |
Species Yersinia pestis [TaxId:632] [280584] (5 PDB entries) |
Domain d5c1pc2: 5c1p C:97-306 [312750] Other proteins in same PDB: d5c1pa1, d5c1pb1, d5c1pc1, d5c1pd1 automated match to d1iova2 complexed with act, adp, dal, gol, na |
PDB Entry: 5c1p (more details), 2.4 Å
SCOPe Domain Sequences for d5c1pc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5c1pc2 d.142.1.0 (C:97-306) automated matches {Yersinia pestis [TaxId: 632]} klrtklvwqalglpispyvalnrqqfetlspeelvacvaklglplivkpshegssvgmsk vdhaselqkalveafqhdsdvliekwlsgpeftvailgdevlpsiriqppgvfydydaky lsdktqyfcpsglsdeseqqlaalalqayhaldcsgwgrvdvmqdrdghfyllevntspg mtshslvpmaarqyglsfsqlvarilmlad
Timeline for d5c1pc2: