Lineage for d1ordb1 (1ord B:1-107)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2463695Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2464058Family c.23.1.4: Ornithine decarboxylase N-terminal "wing" domain [52252] (1 protein)
    automatically mapped to Pfam PF03709
  6. 2464059Protein Ornithine decarboxylase N-terminal "wing" domain [52253] (1 species)
  7. 2464060Species Lactobacillus sp., strain 30a [TaxId:1591] [52254] (2 PDB entries)
  8. 2464062Domain d1ordb1: 1ord B:1-107 [31275]
    Other proteins in same PDB: d1orda2, d1orda3, d1ordb2, d1ordb3
    complexed with plp

Details for d1ordb1

PDB Entry: 1ord (more details), 3 Å

PDB Description: crystallographic structure of a plp-dependent ornithine decarboxylase from lactobacillus 30a to 3.1 angstroms resolution
PDB Compounds: (B:) ornithine decarboxylase

SCOPe Domain Sequences for d1ordb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ordb1 c.23.1.4 (B:1-107) Ornithine decarboxylase N-terminal "wing" domain {Lactobacillus sp., strain 30a [TaxId: 1591]}
ssslkiastqearqyfdtdrvvvdavgsdftdvgaviamdyetdvidaadatkfgipvfa
vtkdaqaisadelkkifhiidlenkfdatvnareietavnnyedsil

SCOPe Domain Coordinates for d1ordb1:

Click to download the PDB-style file with coordinates for d1ordb1.
(The format of our PDB-style files is described here.)

Timeline for d1ordb1: