Lineage for d5c46f_ (5c46 F:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2447791Family c.37.1.8: G proteins [52592] (80 protein domains)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2448880Protein automated matches [190047] (29 species)
    not a true protein
  7. 2448966Species Human (Homo sapiens) [TaxId:9606] [186768] (186 PDB entries)
  8. 2449253Domain d5c46f_: 5c46 F: [312745]
    automated match to d2bcgy_
    complexed with gsp, mg, so4

Details for d5c46f_

PDB Entry: 5c46 (more details), 2.65 Å

PDB Description: crystal structure of an engineered construct of phosphatidylinositol 4 kinase iii beta in complex with gtp gamma s loaded rab11
PDB Compounds: (F:) Ras-related protein Rab-11A

SCOPe Domain Sequences for d5c46f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c46f_ c.37.1.8 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
deydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiw
dtagleryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnk
sdlrhlravptdearafaeknglsfietsaldstnveaafqtilteiyrivsqkq

SCOPe Domain Coordinates for d5c46f_:

Click to download the PDB-style file with coordinates for d5c46f_.
(The format of our PDB-style files is described here.)

Timeline for d5c46f_: