SCOPe 2.08: Domain d5c8la_: 5c8l A:

Lineage for d5c8la_ (5c8l A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (8 families)

5. Family d.113.1.0: automated matches [191580] (1 protein)
   not a true family

6. Protein automated matches [191036] (17 species)
   not a true protein

7. Species Bdellovibrio bacteriovorus [TaxId:264462] [312720] (3 PDB entries)

8. Domain d5c8la_: 5c8l A: [312735]
   automated match to d1vhzb_
   complexed with glc, gol, peg, so4

Details for d5c8la_

PDB Entry: 5c8l, 1.8 Å

PDB Description: crystal structure of the bdellovibrio bacteriovorus nucleoside diphosphate sugar hydrolase

PDB Compounds: (A:) NudF protein

SCOPe Domain Sequences for d5c8la_:

Sequence; same for both SEQRES and ATOM records:

>d5c8la_ d.113.1.0 (A:) automated matches {Bdellovibrio bacteriovorus [TaxId: 264462]}
mkhleektlstrqifkgrylkieqdqvqapdgrtytreyilhpgaammipllpngnvvmi
hqyrhavkkvflefpagkrdhneetlltakrelleetgyeakdwkflttihpvigysneh
idlylardlthleqrldqgqfievvevkpadlmqlvlegkvsdvktqigafwldkflrge
wn

Timeline for d5c8la_:

• d5c8la_ first appeared in SCOPe 2.06
  
• d5c8la_ appears in SCOPe 2.07