![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
![]() | Superfamily d.113.1: Nudix [55811] (8 families) ![]() |
![]() | Family d.113.1.0: automated matches [191580] (1 protein) not a true family |
![]() | Protein automated matches [191036] (17 species) not a true protein |
![]() | Species Bdellovibrio bacteriovorus [TaxId:264462] [312720] (3 PDB entries) |
![]() | Domain d5c7ta_: 5c7t A: [312730] automated match to d1vhzb_ complexed with apr, gol, peg, pg0, pge, so4 |
PDB Entry: 5c7t (more details), 2.06 Å
SCOPe Domain Sequences for d5c7ta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5c7ta_ d.113.1.0 (A:) automated matches {Bdellovibrio bacteriovorus [TaxId: 264462]} mkhleektlstrqifkgrylkieqdqvqapdgrtytreyilhpgaammipllpngnvvmi hqyrhavkkvflefpagkrdhneetlltakrelleetgyeakdwkflttihpvigysneh idlylardlthleqrldqgqfievvevkpadlmqlvlegkvsdvktqigafwldkflrge wn
Timeline for d5c7ta_: