Lineage for d5c7ta_ (5c7t A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971307Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2971308Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2971788Family d.113.1.0: automated matches [191580] (1 protein)
    not a true family
  6. 2971789Protein automated matches [191036] (17 species)
    not a true protein
  7. 2971807Species Bdellovibrio bacteriovorus [TaxId:264462] [312720] (3 PDB entries)
  8. 2971812Domain d5c7ta_: 5c7t A: [312730]
    automated match to d1vhzb_
    complexed with apr, gol, peg, pg0, pge, so4

Details for d5c7ta_

PDB Entry: 5c7t (more details), 2.06 Å

PDB Description: crystal structure of the bdellovibrio bacteriovorus nucleoside diphosphate sugar hydrolase in complex with adp-ribose
PDB Compounds: (A:) NudF protein

SCOPe Domain Sequences for d5c7ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c7ta_ d.113.1.0 (A:) automated matches {Bdellovibrio bacteriovorus [TaxId: 264462]}
mkhleektlstrqifkgrylkieqdqvqapdgrtytreyilhpgaammipllpngnvvmi
hqyrhavkkvflefpagkrdhneetlltakrelleetgyeakdwkflttihpvigysneh
idlylardlthleqrldqgqfievvevkpadlmqlvlegkvsdvktqigafwldkflrge
wn

SCOPe Domain Coordinates for d5c7ta_:

Click to download the PDB-style file with coordinates for d5c7ta_.
(The format of our PDB-style files is described here.)

Timeline for d5c7ta_: