Lineage for d5ayef_ (5aye F:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2807321Fold b.67: 5-bladed beta-propeller [50933] (4 superfamilies)
    consists of five 4-stranded beta-sheet motifs; meander
  4. 2807331Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families) (S)
  5. 2807462Family b.67.2.4: TM1225-like predicted glycosylases [110284] (2 proteins)
    Pfam PF04041 DUF377
  6. 2807471Protein automated matches [273186] (2 species)
    not a true protein
  7. 2807472Species Ruminococcus albus [TaxId:697329] [312516] (2 PDB entries)
  8. 2807478Domain d5ayef_: 5aye F: [312724]
    automated match to d1vkde_
    complexed with po4

Details for d5ayef_

PDB Entry: 5aye (more details), 2.2 Å

PDB Description: crystal structure of ruminococcus albus beta-(1,4)- mannooligosaccharide phosphorylase (ramp2) in complexes with phosphate and beta-(1,4)-mannobiose
PDB Compounds: (F:) Beta-1,4-mannooligosaccharide phosphorylase

SCOPe Domain Sequences for d5ayef_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ayef_ b.67.2.4 (F:) automated matches {Ruminococcus albus [TaxId: 697329]}
mktqiingvslpnipwqdkpadckdviwrydanpiiprdqlptsnsifnsavvpyesekg
kfagvfrvddkcrnmelhagfskdgihwdinpdrivfeqaeksteevnqwgygydprvcf
iedrfwvtwcnaygwkptigvaytfdfktfyqcenaflpfnrngvlfprkingkyvmfsr
psdsghtpfgdmfisqspdmkywgehrhvmgplraweskkigagpipietsegwlcfyhg
vlescngfvysfsacildkdepwkvkyrcaeyllspqkiyecvgdvqnvtfpcatlvdad
tgriaiyygcadtcvsmafttvddvvdyvkshssv

SCOPe Domain Coordinates for d5ayef_:

Click to download the PDB-style file with coordinates for d5ayef_.
(The format of our PDB-style files is described here.)

Timeline for d5ayef_: