![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
![]() | Superfamily c.72.1: Ribokinase-like [53613] (6 families) ![]() has extra strand located between strands 2 and 3 |
![]() | Family c.72.1.0: automated matches [191321] (1 protein) not a true family |
![]() | Protein automated matches [190117] (50 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:282458] [312718] (3 PDB entries) |
![]() | Domain d5cgah_: 5cga H: [312719] Other proteins in same PDB: d5cgaa2, d5cgae2 automated match to d3hpda_ complexed with kp6, mg |
PDB Entry: 5cga (more details), 1.87 Å
SCOPe Domain Sequences for d5cgah_:
Sequence, based on SEQRES records: (download)
>d5cgah_ c.72.1.0 (H:) automated matches {Staphylococcus aureus [TaxId: 282458]} mnylnnirienplticytndvvknftangllsigaspamseapeeaeefykvaqallini gtltaqneqdiiaiaqtaneaglpivfdpvavgastyrkqfcklllksakvsvikgnase ilaliddtatmkgtdsdanldavtiakkayaiyktaivitgkedvivqgdkaivlangsp llarvtgagcllggiiagflfretepdiealieavsvfniaaevaaenencggpgtfspl lldtlyhlnettyqqriri
>d5cgah_ c.72.1.0 (H:) automated matches {Staphylococcus aureus [TaxId: 282458]} mnylnnirienplticytndvvknftangllsigaspamseapeeaeefykvaqallini gtltaqneqdiiaiaqtaneaglpivfdpvavgastyrkqfcklllksakvsvikgnase ilalidldavtiakkayaiyktaivitgkedvivqgdkaivlangspllarvtgagcllg giiagflfretepdiealieavsvfniaaevaaenencggpgtfspllldtlyhlnetty qqriri
Timeline for d5cgah_: