Lineage for d5brpa2 (5brp A:479-560)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
folded sheet; greek-keySuperfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) 
this domain is C-terminal to the catalytic beta/alpha barrel domain
Family b.71.1.0: automated matches [227134] (1 protein)
not a true familyProtein automated matches [226835] (41 species)
not a true protein
Species Bacillus licheniformis [TaxId:279010] [312607] (2 PDB entries) 
Domain d5brpa2: 5brp A:479-560 [312717]
Other proteins in same PDB: d5brpa1, d5brpb1, d5brpc1, d5brpd1
automated match to d1uoka1
complexed with mg, png; mutant
Details for d5brpa2
PDB Entry: 5brp (more details), 2.05 Å
PDB Description: crystal structure of bacillus licheniformis trehalose-6-phosphate hydrolase (trea), mutant r201q, in complex with png
PDB Compounds: (A:) Glycoside Hydrolase Family 13SCOPe Domain Sequences for d5brpa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5brpa2 b.71.1.0 (A:479-560) automated matches {Bacillus licheniformis [TaxId: 279010]}
gdyqlileddqelyaylrngadekllvinnfygketefqlpddidiegydakvlisndtd
lpesfkrftvkpyqsivyhlak
SCOPe Domain Coordinates for d5brpa2:
Click to download the PDB-style file with coordinates for d5brpa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5brpa2:
View in 3D
