SCOPe 2.08: Domain d5ar6a1: 5ar6 A:1-119

Lineage for d5ar6a1 (5ar6 A:1-119)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.0: automated matches [191478] (1 protein)
   not a true family

6. Protein automated matches [190767] (7 species)
   not a true protein

7. Species Pig (Sus scrofa) [TaxId:9823] [312711] (1 PDB entry)

8. Domain d5ar6a1: 5ar6 A:1-119 [312712]
   Other proteins in same PDB: d5ar6a2
   automated match to d1agia_
   complexed with edo

Details for d5ar6a1

PDB Entry: 5ar6, 1.25 Å

PDB Description: crystal structure of porcine rnase 4

PDB Compounds: (A:) ribonuclease 4

SCOPe Domain Sequences for d5ar6a1:

Sequence; same for both SEQRES and ATOM records:

>d5ar6a1 d.5.1.0 (A:1-119) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
qdrmyqrflrqhvdpdatggndaycnlmmqrrkmtshyckrfntfihediwnirsicsts
niqckngqmnchegvvkvtdcretgssrapncryramastrrvviacegnpevpvhfdk

Timeline for d5ar6a1:

• d5ar6a1 first appeared in SCOPe 2.06
  
• d5ar6a1 appears in SCOPe 2.07