Lineage for d2reqd2 (2req D:476-637)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2102924Superfamily c.23.6: Cobalamin (vitamin B12)-binding domain [52242] (1 family) (S)
  5. 2102925Family c.23.6.1: Cobalamin (vitamin B12)-binding domain [52243] (5 protein domains)
  6. 2102967Protein Methylmalonyl-CoA mutase beta subunit, C-terminal domain [88719] (1 species)
    inactive subunit
  7. 2102968Species Propionibacterium freudenreichii, subsp. shermanii [TaxId:1744] [88720] (8 PDB entries)
  8. 2102982Domain d2reqd2: 2req D:476-637 [31270]
    Other proteins in same PDB: d2reqa1, d2reqa2, d2reqb1, d2reqc1, d2reqc2, d2reqd1
    complexed with b12, coa

Details for d2reqd2

PDB Entry: 2req (more details), 2.5 Å

PDB Description: methylmalonyl-coa mutase, non-productive coa complex, in open conformation representing substrate-free state
PDB Compounds: (D:) methylmalonyl-coa mutase

SCOPe Domain Sequences for d2reqd2:

Sequence, based on SEQRES records: (download)

>d2reqd2 c.23.6.1 (D:476-637) Methylmalonyl-CoA mutase beta subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]}
tkpfpaaparkglawhrdsevfeqlmdrstsvserpkvflaclgtrrdfggregfsspvw
hiagidtpqveggttaeiveafkksgaqvadlcssakvyaqqglevakalkaagakalyl
sgafkefgddaaeaeklidgrlfmgmdvvdtlsstldilgva

Sequence, based on observed residues (ATOM records): (download)

>d2reqd2 c.23.6.1 (D:476-637) Methylmalonyl-CoA mutase beta subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]}
tkpfpaaparkglawhrdsevfeqlmdrstsvserpkvflaclgtrrdfggregfsspvw
hiagidtpqvettaeiveafkksgaqvadlcssakvyaqqglevakalkaagakalylsg
afkefgddaaeaeklidgrlfmgmdvvdtlsstldilgva

SCOPe Domain Coordinates for d2reqd2:

Click to download the PDB-style file with coordinates for d2reqd2.
(The format of our PDB-style files is described here.)

Timeline for d2reqd2: