SCOPe 2.07: Domain d5c1pb2: 5c1p B:97-306

Lineage for d5c1pb2 (5c1p B:97-306)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families)

5. Family d.142.1.0: automated matches [227184] (1 protein)
   not a true family

6. Protein automated matches [226904] (38 species)
   not a true protein

7. Species Yersinia pestis [TaxId:632] [280584] (5 PDB entries)

8. Domain d5c1pb2: 5c1p B:97-306 [312692]
   Other proteins in same PDB: d5c1pa1, d5c1pb1, d5c1pc1, d5c1pd1
   automated match to d1iova2
   complexed with act, adp, dal, gol, na

Details for d5c1pb2

PDB Entry: 5c1p, 2.4 Å

PDB Description: crystal structure of adp and d-alanyl-d-alanine complexed d-alanine-d- alanine ligase(ddl) from yersinia pestis

PDB Compounds: (B:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d5c1pb2:

Sequence, based on SEQRES records:

>d5c1pb2 d.142.1.0 (B:97-306) automated matches {Yersinia pestis [TaxId: 632]}
klrtklvwqalglpispyvalnrqqfetlspeelvacvaklglplivkpshegssvgmsk
vdhaselqkalveafqhdsdvliekwlsgpeftvailgdevlpsiriqppgvfydydaky
lsdktqyfcpsglsdeseqqlaalalqayhaldcsgwgrvdvmqdrdghfyllevntspg
mtshslvpmaarqyglsfsqlvarilmlad

Sequence, based on observed residues (ATOM records):

>d5c1pb2 d.142.1.0 (B:97-306) automated matches {Yersinia pestis [TaxId: 632]}
klrtklvwqalglpispyvalnrqqfetlspeelvacvaklglplivkpshvgmskvdha
selqkalveafqhdsdvliekwlsgpeftvailgdevlpsiriqppgvfydydakktqyf
cpsglsdeseqqlaalalqayhaldcsgwgrvdvmqdrdghfyllevntspgmtshslvp
maarqyglsfsqlvarilmlad

Timeline for d5c1pb2:

• d5c1pb2 first appeared in SCOPe 2.06
  
• d5c1pb2 appears in the current release, SCOPe 2.08