Lineage for d5arja1 (5arj A:1-119)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928015Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 2928016Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 2928017Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 2928489Protein automated matches [190061] (7 species)
    not a true protein
  7. 2928642Species Pig (Sus scrofa) [TaxId:9823] [312520] (3 PDB entries)
  8. 2928651Domain d5arja1: 5arj A:1-119 [312690]
    Other proteins in same PDB: d5arja2, d5arjc2, d5arjd2
    automated match to d2rnfa_
    mutant

Details for d5arja1

PDB Entry: 5arj (more details), 2.9 Å

PDB Description: crystal structure of porcine rnase 4 d80a mutant
PDB Compounds: (A:) ribonuclease 4

SCOPe Domain Sequences for d5arja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5arja1 d.5.1.1 (A:1-119) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
qdrmyqrflrqhvdpdatggndaycnlmmqrrkmtshyckrfntfihediwnirsicsts
niqckngqmnchegvvkvtacretgssrapncryramastrrvviacegnpevpvhfdk

SCOPe Domain Coordinates for d5arja1:

Click to download the PDB-style file with coordinates for d5arja1.
(The format of our PDB-style files is described here.)

Timeline for d5arja1: