Lineage for d5b0aa_ (5b0a A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949708Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2950158Family d.58.4.0: automated matches [191316] (1 protein)
    not a true family
  6. 2950159Protein automated matches [190081] (33 species)
    not a true protein
  7. 2950210Species Cannabis sativa [TaxId:3483] [312528] (9 PDB entries)
  8. 2950223Domain d5b0aa_: 5b0a A: [312684]
    automated match to d1q4ra_
    mutant

Details for d5b0aa_

PDB Entry: 5b0a (more details), 2.1 Å

PDB Description: polyketide cyclase oac from cannabis sativa, h5q mutant
PDB Compounds: (A:) Olivetolic acid cyclase

SCOPe Domain Sequences for d5b0aa_:

Sequence, based on SEQRES records: (download)

>d5b0aa_ d.58.4.0 (A:) automated matches {Cannabis sativa [TaxId: 3483]}
avkqlivlkfkdeiteaqkeeffktyvnlvniipamkdvywgkdvtqknkeegythivev
tfesvetiqdyiihpahvgfgdvyrsfwekllifdytprk

Sequence, based on observed residues (ATOM records): (download)

>d5b0aa_ d.58.4.0 (A:) automated matches {Cannabis sativa [TaxId: 3483]}
avkqlivlkfkdeiteaqkeeffktyvnlvniipamkdvywgkdvtqkngythivevtfv
etiqdyiihpahvgfgdvyrsfwekllifdytprk

SCOPe Domain Coordinates for d5b0aa_:

Click to download the PDB-style file with coordinates for d5b0aa_.
(The format of our PDB-style files is described here.)

Timeline for d5b0aa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5b0ab_