Lineage for d2reqb2 (2req B:476-637)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.23: Flavodoxin-like [52171] (17 superfamilies) 
Superfamily c.23.6: Cobalamin (vitamin B12)-binding domain [52242] (1 family) 
Family c.23.6.1: Cobalamin (vitamin B12)-binding domain [52243] (3 proteins) 
Protein Methylmalonyl-CoA mutase C-terminal domains of alpha and beta subunits [52249] (1 species) Species Propionibacterium freudenreichii, subsp. shermanii [TaxId:1744] [52250] (8 PDB entries) 
Domain d2reqb2: 2req B:476-637 [31268]
Other proteins in same PDB: d2reqa1, d2reqb1, d2reqc1, d2reqd1
Details for d2reqb2
PDB Entry: 2req (more details), 2.5 Å
PDB Description: methylmalonyl-coa mutase, non-productive coa complex, in open conformation representing substrate-free state
SCOP Domain Sequences for d2reqb2:
Sequence, based on SEQRES records: (download)
>d2reqb2 c.23.6.1 (B:476-637) Methylmalonyl-CoA mutase C-terminal domains of alpha and beta subunits {Propionibacterium freudenreichii, subsp. shermanii}
tkpfpaaparkglawhrdsevfeqlmdrstsvserpkvflaclgtrrdfggregfsspvw
hiagidtpqveggttaeiveafkksgaqvadlcssakvyaqqglevakalkaagakalyl
sgafkefgddaaeaeklidgrlfmgmdvvdtlsstldilgva
Sequence, based on observed residues (ATOM records): (download)
>d2reqb2 c.23.6.1 (B:476-637) Methylmalonyl-CoA mutase C-terminal domains of alpha and beta subunits {Propionibacterium freudenreichii, subsp. shermanii}
tkpfpaaparkglawhrdsevfeqlmdrstsvserpkvflaclgtrrdfggregfsspvw
hiagidtpqvettaeiveafkksgaqvadlcssakvyaqqglevakalkaagakalylsg
afkefgddaaeaeklidgrlfmgmdvvdtlsstldilgva
SCOP Domain Coordinates for d2reqb2:
Click to download the PDB-style file with coordinates for d2reqb2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2reqb2:
View in 3D
