SCOPe 2.08: Domain d5bqdb_: 5bqd B:

Lineage for d5bqdb_ (5bqd B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (8 families)

5. Family b.2.5.4: T-box [81316] (3 proteins)
   automatically mapped to Pfam PF00907

6. Protein automated matches [191154] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189324] (4 PDB entries)

8. Domain d5bqdb_: 5bqd B: [312676]
   automated match to d2x6va_
   complexed with mg

Details for d5bqdb_

PDB Entry: 5bqd, 2.58 Å

PDB Description: crystal structure of tbx5 (1-239) dimer

PDB Compounds: (B:) t-box transcription factor tbx5

SCOPe Domain Sequences for d5bqdb_:

Sequence, based on SEQRES records:

>d5bqdb_ b.2.5.4 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ftqqgmegikvflherelwlkfhevgtemiitkagrrmfpsykvkvtglnpktkyillmd
ivpaddhrykfadnkwsvtgkaepampgrlyvhpdspatgahwmrqlvsfqklkltnnhl
dpfghiilnsmhkyqprlhivkadenngfgskntafcthvfpetafiavtsyqnhkitql
kienn

Sequence, based on observed residues (ATOM records):

>d5bqdb_ b.2.5.4 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ftqqgmegikvflherelwlkfhevgtemiitkagrrmfpsykvkvtglnpktkyillmd
ivpaddhrykfadnkwsvtgkaepampgrlyvhpdspatgahwmrqlvsfqklkltnnhl
dpfghiilnsmhkyqprlhivkantafcthvfpetafiavtsyqnhkitqlkienn

Timeline for d5bqdb_:

• d5bqdb_ first appeared in SCOPe 2.06
  
• d5bqdb_ appears in SCOPe 2.07