SCOPe 2.06: Domain d5c5yd_: 5c5y D:

Lineage for d5c5yd_ (5c5y D:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (13 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein automated matches [190095] (24 species)
   not a true protein

7. Species Colwellia psychrerythraea [TaxId:167879] [312672] (1 PDB entry)

8. Domain d5c5yd_: 5c5y D: [312673]
   automated match to d1p1xa_
   complexed with gol, unl

Details for d5c5yd_

PDB Entry: 5c5y, 2.1 Å

PDB Description: crystal structure of deoxyribose-phosphate aldolase from colwellia psychrerythraea (hexagonal form)

PDB Compounds: (D:) deoxyribose-phosphate aldolase

SCOPe Domain Sequences for d5c5yd_:

Sequence; same for both SEQRES and ATOM records:

>d5c5yd_ c.1.10.1 (D:) automated matches {Colwellia psychrerythraea [TaxId: 167879]}
sdikavaqralslmdltsltntetdqeiidlcrqakspagetaaicifprfipvakkalk
aqqtphikiatvtnfpqgnddldialaetraavaygadevdlvfpyraliqgnetigfdm
vkvckqacsgnaklkviietgelkseelirkaseiainagadfiktstgkvainatpeaa
kvmltviknkntavgfkpaggvrnaddaaiyldladnilgnewadanhfrfgassllisl
ldtlghk

Timeline for d5c5yd_:

• d5c5yd_ is new in SCOPe 2.06-stable
  
• d5c5yd_ appears in SCOPe 2.07
  
• d5c5yd_ appears in the current release, SCOPe 2.08