SCOPe 2.06: Domain d2reqa2: 2req A:561-728

Lineage for d2reqa2 (2req A:561-728)

Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
Superfamily c.23.6: Cobalamin (vitamin B12)-binding domain [52242] (1 family)
Family c.23.6.1: Cobalamin (vitamin B12)-binding domain [52243] (5 proteins)
Protein Methylmalonyl-CoA mutase alpha subunit, C-terminal domain [88717] (1 species)
active subunit; binds B12
Species Propionibacterium freudenreichii, subsp. shermanii [TaxId:1744] [88718] (8 PDB entries)
Domain d2reqa2: 2req A:561-728 [31267]
Other proteins in same PDB: d2reqa1, d2reqb1, d2reqb2, d2reqc1, d2reqd1, d2reqd2
complexed with b12, coa

Details for d2reqa2

PDB Entry: 2req (more details), 2.5 Å

PDB Description: methylmalonyl-coa mutase, non-productive coa complex, in open conformation representing substrate-free state

PDB Compounds: (A:) methylmalonyl-coa mutase

SCOPe Domain Sequences for d2reqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2reqa2 c.23.6.1 (A:561-728) Methylmalonyl-CoA mutase alpha subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]}
aqirtisgvyskevkntpeveearelveefeqaegrrprillakmgqdghdrgqkviata
yadlgfdvdvgplfqtpeetarqaveadvhvvgvsslagghltlvpalrkeldklgrpdi
litvggvipeqdfdelrkdgaveiytpgtvipesaislvkklraslda

SCOPe Domain Coordinates for d2reqa2:

Click to download the PDB-style file with coordinates for d2reqa2.
(The format of our PDB-style files is described here.)

Timeline for d2reqa2: