SCOPe 2.08: Domain d5brqc2: 5brq C:479-560

Lineage for d5brqc2 (5brq C:479-560)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.0: automated matches [227134] (1 protein)
   not a true family

6. Protein automated matches [226835] (41 species)
   not a true protein

7. Species Bacillus licheniformis [TaxId:279010] [312607] (2 PDB entries)

8. Domain d5brqc2: 5brq C:479-560 [312661]
   Other proteins in same PDB: d5brqa1, d5brqb1, d5brqc1, d5brqd1
   automated match to d1uoka1
   complexed with mg

Details for d5brqc2

PDB Entry: 5brq, 2 Å

PDB Description: crystal structure of bacillus licheniformis trehalose-6-phosphate hydrolase (trea)

PDB Compounds: (C:) Glycoside Hydrolase Family 13

SCOPe Domain Sequences for d5brqc2:

Sequence; same for both SEQRES and ATOM records:

>d5brqc2 b.71.1.0 (C:479-560) automated matches {Bacillus licheniformis [TaxId: 279010]}
gdyqlileddqelyaylrngadekllvinnfygketefqlpddidiegydakvlisndtd
lpesfkrftvkpyqsivyhlak

Timeline for d5brqc2:

• d5brqc2 first appeared in SCOPe 2.06
  
• d5brqc2 appears in SCOPe 2.07