Lineage for d5brqc2 (5brq C:479-560)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2400339Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2400340Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2400933Family b.71.1.0: automated matches [227134] (1 protein)
    not a true family
  6. 2400934Protein automated matches [226835] (34 species)
    not a true protein
  7. 2400947Species Bacillus licheniformis [TaxId:279010] [312607] (2 PDB entries)
  8. 2400950Domain d5brqc2: 5brq C:479-560 [312661]
    Other proteins in same PDB: d5brqa1, d5brqb1, d5brqc1, d5brqd1
    automated match to d1uoka1
    complexed with mg

Details for d5brqc2

PDB Entry: 5brq (more details), 2 Å

PDB Description: crystal structure of bacillus licheniformis trehalose-6-phosphate hydrolase (trea)
PDB Compounds: (C:) Glycoside Hydrolase Family 13

SCOPe Domain Sequences for d5brqc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5brqc2 b.71.1.0 (C:479-560) automated matches {Bacillus licheniformis [TaxId: 279010]}
gdyqlileddqelyaylrngadekllvinnfygketefqlpddidiegydakvlisndtd
lpesfkrftvkpyqsivyhlak

SCOPe Domain Coordinates for d5brqc2:

Click to download the PDB-style file with coordinates for d5brqc2.
(The format of our PDB-style files is described here.)

Timeline for d5brqc2: