Lineage for d5brja_ (5brj A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2438294Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2438295Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2438674Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2438675Protein automated matches [190131] (73 species)
    not a true protein
  7. 2438684Species Agrobacterium tumefaciens [TaxId:1082932] [312657] (1 PDB entry)
  8. 2438685Domain d5brja_: 5brj A: [312658]
    automated match to d1k68a_
    complexed with mg

Details for d5brja_

PDB Entry: 5brj (more details), 1.92 Å

PDB Description: structure of the bacteriophytochrome response regulator atbrr
PDB Compounds: (A:) Two component response regulator

SCOPe Domain Sequences for d5brja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5brja_ c.23.1.0 (A:) automated matches {Agrobacterium tumefaciens [TaxId: 1082932]}
pelrpillvednprdleltltalekcqlanevvvardgtealdylnvtgsyhnrpggdpa
vvlldlklpkvdglevlqtvkgsdhlrhipvvmltssreeqdlvrsyelgvnafvvkpve
fnqffkaiqdlgvfwallne

SCOPe Domain Coordinates for d5brja_:

Click to download the PDB-style file with coordinates for d5brja_.
(The format of our PDB-style files is described here.)

Timeline for d5brja_: