Lineage for d1e1cc2 (1e1c C:561-728)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2857119Superfamily c.23.6: Cobalamin (vitamin B12)-binding domain [52242] (1 family) (S)
  5. 2857120Family c.23.6.1: Cobalamin (vitamin B12)-binding domain [52243] (5 proteins)
  6. 2857149Protein Methylmalonyl-CoA mutase alpha subunit, C-terminal domain [88717] (1 species)
    active subunit; binds B12
  7. 2857150Species Propionibacterium freudenreichii, subsp. shermanii [TaxId:1744] [88718] (8 PDB entries)
  8. 2857164Domain d1e1cc2: 1e1c C:561-728 [31265]
    Other proteins in same PDB: d1e1ca1, d1e1cb1, d1e1cb2, d1e1cc1, d1e1cd1, d1e1cd2
    complexed with b12, dca; mutant

Details for d1e1cc2

PDB Entry: 1e1c (more details), 2.62 Å

PDB Description: methylmalonyl-coa mutase h244a mutant
PDB Compounds: (C:) methylmalonyl-coa mutase alpha chain

SCOPe Domain Sequences for d1e1cc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e1cc2 c.23.6.1 (C:561-728) Methylmalonyl-CoA mutase alpha subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]}
aqirtisgvyskevkntpeveearelveefeqaegrrprillakmgqdghdrgqkviata
yadlgfdvdvgplfqtpeetarqaveadvhvvgvsslagghltlvpalrkeldklgrpdi
litvggvipeqdfdelrkdgaveiytpgtvipesaislvkklraslda

SCOPe Domain Coordinates for d1e1cc2:

Click to download the PDB-style file with coordinates for d1e1cc2.
(The format of our PDB-style files is described here.)

Timeline for d1e1cc2: