Lineage for d5bmge_ (5bmg E:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2541749Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 2541750Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)
  6. 2541775Protein Immunoglobulin-binding protein G, different constituent domains [54360] (4 species)
  7. 2541779Species Streptococcus sp. [TaxId:1320] [193546] (12 PDB entries)
  8. 2541800Domain d5bmge_: 5bmg E: [312648]
    automated match to d2qmta_
    complexed with mtn, trs; mutant

Details for d5bmge_

PDB Entry: 5bmg (more details), 2.2 Å

PDB Description: nitroxide spin labels in protein gb1: e15 mutant
PDB Compounds: (E:) Immunoglobulin G-binding protein G

SCOPe Domain Sequences for d5bmge_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bmge_ d.15.7.1 (E:) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp. [TaxId: 1320]}
mqyklilngktlkgcttteavdaataekvfkqyandngvdgewtyddatktftvte

SCOPe Domain Coordinates for d5bmge_:

Click to download the PDB-style file with coordinates for d5bmge_.
(The format of our PDB-style files is described here.)

Timeline for d5bmge_: