Lineage for d5brqb1 (5brq B:6-478)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2416558Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2418840Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2418841Protein automated matches [190075] (97 species)
    not a true protein
  7. 2418894Species Bacillus licheniformis [TaxId:279010] [312605] (2 PDB entries)
  8. 2418896Domain d5brqb1: 5brq B:6-478 [312641]
    Other proteins in same PDB: d5brqa2, d5brqb2, d5brqc2, d5brqd2
    automated match to d1uoka2
    complexed with mg

Details for d5brqb1

PDB Entry: 5brq (more details), 2 Å

PDB Description: crystal structure of bacillus licheniformis trehalose-6-phosphate hydrolase (trea)
PDB Compounds: (B:) Glycoside Hydrolase Family 13

SCOPe Domain Sequences for d5brqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5brqb1 c.1.8.0 (B:6-478) automated matches {Bacillus licheniformis [TaxId: 279010]}
npwwkkavvyqiypksfkdttgngvgdirgiiekldyikelacdviwltpiyqspqndng
ydisdyysiheeygtmadfeelleeahkrgikvimdlvvnhtstehrwfkeaasgkenly
rdfyiwkdmkpngapptnweskfggsawefhaesgqyylhlydvtqadlnweneavrkkv
yemmhfwfekgidgfrldvinviskdqrfpdddegdgrrfytdgprvheflnemnrevfs
kydsmtvgemssttiadcirytnpesreldmvfnfhhlkadypngekwaladfdflklkk
ilsewqtemnkgggwnalfwcnhdqprivsrygddgkyrkksakmlataihmlqgtpyiy
qgeelgmtnpkfddislyrdveslnmyrilkeagkpeaeiieilkaksrdnsrtpvqwng
eenagftagtpwipvpdnykeinaeealndpdsifyhykklnelrkefdiitt

SCOPe Domain Coordinates for d5brqb1:

Click to download the PDB-style file with coordinates for d5brqb1.
(The format of our PDB-style files is described here.)

Timeline for d5brqb1: