Lineage for d1e1cb2 (1e1c B:476-638)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. Superfamily c.23.6: Cobalamin (vitamin B12)-binding domain [52242] (1 family) (S)
  5. Family c.23.6.1: Cobalamin (vitamin B12)-binding domain [52243] (5 proteins)
  6. Protein Methylmalonyl-CoA mutase beta subunit, C-terminal domain [88719] (1 species)
    inactive subunit
  7. Species Propionibacterium freudenreichii, subsp. shermanii [TaxId:1744] [88720] (8 PDB entries)
  8. Domain d1e1cb2: 1e1c B:476-638 [31264]
    Other proteins in same PDB: d1e1ca1, d1e1ca2, d1e1cb1, d1e1cc1, d1e1cc2, d1e1cd1
    complexed with b12, dca; mutant

Details for d1e1cb2

PDB Entry: 1e1c (more details), 2.62 Å

PDB Description: methylmalonyl-coa mutase h244a mutant
PDB Compounds: (B:) methylmalonyl-coa mutase beta chain

SCOPe Domain Sequences for d1e1cb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e1cb2 c.23.6.1 (B:476-638) Methylmalonyl-CoA mutase beta subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]}
tkpfpaaparkglawhrdsevfeqlmdrstsvserpkvflaclgtrrdfggregfsspvw
hiagidtpqveggttaeiveafkksgaqvadlcssakvyaqqglevakalkaagakalyl
sgafkefgddaaeaeklidgrlfmgmdvvdtlsstldilgvak

SCOPe Domain Coordinates for d1e1cb2 are not available.

Timeline for d1e1cb2:

Domains from same chain:
(mouse over for more information)
d1e1cb1
Domains from other chains:
(mouse over for more information)
d1e1ca1, d1e1ca2, d1e1cc1, d1e1cc2, d1e1cd1, d1e1cd2