Class b: All beta proteins [48724] (180 folds) |
Fold b.67: 5-bladed beta-propeller [50933] (4 superfamilies) consists of five 4-stranded beta-sheet motifs; meander |
Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families) |
Family b.67.2.4: TM1225-like predicted glycosylases [110284] (2 proteins) Pfam PF04041 DUF377 |
Protein automated matches [273186] (2 species) not a true protein |
Species Ruminococcus albus [TaxId:697329] [312516] (2 PDB entries) |
Domain d5ayea_: 5aye A: [312632] automated match to d1vkde_ complexed with po4 |
PDB Entry: 5aye (more details), 2.2 Å
SCOPe Domain Sequences for d5ayea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ayea_ b.67.2.4 (A:) automated matches {Ruminococcus albus [TaxId: 697329]} mktqiingvslpnipwqdkpadckdviwrydanpiiprdqlptsnsifnsavvpyesekg kfagvfrvddkcrnmelhagfskdgihwdinpdrivfeqaeksteevnqwgygydprvcf iedrfwvtwcnaygwkptigvaytfdfktfyqcenaflpfnrngvlfprkingkyvmfsr psdsghtpfgdmfisqspdmkywgehrhvmgplraweskkigagpipietsegwlcfyhg vlescngfvysfsacildkdepwkvkyrcaeyllspqkiyecvgdvqnvtfpcatlvdad tgriaiyygcadtcvsmafttvddvvdyvkshssv
Timeline for d5ayea_: