Lineage for d5b1cb_ (5b1c B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2375023Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2376005Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2376006Protein automated matches [190226] (72 species)
    not a true protein
  7. 2376085Species Dengue virus 4 dominica/814669/1981 [TaxId:408871] [312577] (1 PDB entry)
  8. 2376087Domain d5b1cb_: 5b1c B: [312625]
    Other proteins in same PDB: d5b1ca2
    automated match to d2h0pa_
    complexed with so4; mutant

Details for d5b1cb_

PDB Entry: 5b1c (more details), 2 Å

PDB Description: crystal structure of den4 ed3 mutant with l387i
PDB Compounds: (B:) Envelope protein E

SCOPe Domain Sequences for d5b1cb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b1cb_ b.1.18.0 (B:) automated matches {Dengue virus 4 dominica/814669/1981 [TaxId: 408871]}
ytmcsgkfsidkemaetqhgttvvkvkyegagapckvpieirdvnkekvvgriisstpla
entnsvtnieleppfgdsyivigvgnsaltihwfrkg

SCOPe Domain Coordinates for d5b1cb_:

Click to download the PDB-style file with coordinates for d5b1cb_.
(The format of our PDB-style files is described here.)

Timeline for d5b1cb_: