SCOPe 2.08: Domain d5bphd2: 5bph D:97-306

Lineage for d5bphd2 (5bph D:97-306)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families)

5. Family d.142.1.0: automated matches [227184] (1 protein)
   not a true family

6. Protein automated matches [226904] (39 species)
   not a true protein

7. Species Yersinia pestis [TaxId:632] [280584] (5 PDB entries)

8. Domain d5bphd2: 5bph D:97-306 [312616]
   Other proteins in same PDB: d5bpha1, d5bphb1, d5bphc1, d5bphd1
   automated match to d1iova2
   complexed with act, amp, gol, na

Details for d5bphd2

PDB Entry: 5bph, 1.7 Å

PDB Description: crystal structure of amp complexed d-alanine-d-alanine ligase(ddl) from yersinia pestis

PDB Compounds: (D:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d5bphd2:

Sequence, based on SEQRES records:

>d5bphd2 d.142.1.0 (D:97-306) automated matches {Yersinia pestis [TaxId: 632]}
klrtklvwqalglpispyvalnrqqfetlspeelvacvaklglplivkpshegssvgmsk
vdhaselqkalveafqhdsdvliekwlsgpeftvailgdevlpsiriqppgvfydydaky
lsdktqyfcpsglsdeseqqlaalalqayhaldcsgwgrvdvmqdrdghfyllevntspg
mtshslvpmaarqyglsfsqlvarilmlad

Sequence, based on observed residues (ATOM records):

>d5bphd2 d.142.1.0 (D:97-306) automated matches {Yersinia pestis [TaxId: 632]}
klrtklvwqalglpispyvalnrqqfetlspeelvacvaklglplivkpshessvgmskv
dhaselqkalveafqhdsdvliekwlsgpeftvailgdevlpsiriqppgvfydydaksd
ktqyfcpsglsdeseqqlaalalqayhaldcsgwgrvdvmqdrdghfyllevntspgmts
hslvpmaarqyglsfsqlvarilmlad

Timeline for d5bphd2:

• d5bphd2 first appeared in SCOPe 2.06
  
• d5bphd2 appears in SCOPe 2.07