SCOPe 2.07: Domain d5bphd1: 5bph D:1-96

Lineage for d5bphd1 (5bph D:1-96)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.0: automated matches [227183] (1 protein)
   not a true family

6. Protein automated matches [226903] (39 species)
   not a true protein

7. Species Yersinia pestis [TaxId:632] [280582] (5 PDB entries)

8. Domain d5bphd1: 5bph D:1-96 [312615]
   Other proteins in same PDB: d5bpha2, d5bphb2, d5bphc2, d5bphd2
   automated match to d1iowa1
   complexed with act, amp, gol, na

Details for d5bphd1

PDB Entry: 5bph, 1.7 Å

PDB Description: crystal structure of amp complexed d-alanine-d-alanine ligase(ddl) from yersinia pestis

PDB Compounds: (D:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d5bphd1:

Sequence; same for both SEQRES and ATOM records:

>d5bphd1 c.30.1.0 (D:1-96) automated matches {Yersinia pestis [TaxId: 632]}
maekvavllggtsaerevsllsgqavlaglkeagidaygvdtkdfpvtqlkeqgfdkvfi
alhgrggedgtlqgvleflqlpytgsgvmasaltmd

Timeline for d5bphd1:

• d5bphd1 first appeared in SCOPe 2.06
  
• d5bphd1 appears in the current release, SCOPe 2.08