Lineage for d5brpb2 (5brp B:479-560)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2076868Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2076869Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2077462Family b.71.1.0: automated matches [227134] (1 protein)
    not a true family
  6. 2077463Protein automated matches [226835] (34 species)
    not a true protein
  7. 2077476Species Bacillus licheniformis [TaxId:279010] [312607] (2 PDB entries)
  8. 2077482Domain d5brpb2: 5brp B:479-560 [312608]
    Other proteins in same PDB: d5brpa1, d5brpb1, d5brpc1, d5brpd1
    automated match to d1uoka1
    complexed with mg, png; mutant

Details for d5brpb2

PDB Entry: 5brp (more details), 2.05 Å

PDB Description: crystal structure of bacillus licheniformis trehalose-6-phosphate hydrolase (trea), mutant r201q, in complex with png
PDB Compounds: (B:) Glycoside Hydrolase Family 13

SCOPe Domain Sequences for d5brpb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5brpb2 b.71.1.0 (B:479-560) automated matches {Bacillus licheniformis [TaxId: 279010]}
gdyqlileddqelyaylrngadekllvinnfygketefqlpddidiegydakvlisndtd
lpesfkrftvkpyqsivyhlak

SCOPe Domain Coordinates for d5brpb2:

Click to download the PDB-style file with coordinates for d5brpb2.
(The format of our PDB-style files is described here.)

Timeline for d5brpb2: