Lineage for d5azqa_ (5azq A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2687850Protein Myoglobin [46469] (11 species)
  7. 2687855Species Horse (Equus caballus) [TaxId:9796] [46474] (96 PDB entries)
  8. 2687902Domain d5azqa_: 5azq A: [312588]
    automated match to d1gjna_
    complexed with cyn, j1r, j1s, so4

Details for d5azqa_

PDB Entry: 5azq (more details), 1.4 Å

PDB Description: crystal structure of cyano-cobalt(iii) tetradehydrocorrin in the heme pocket of horse heart myoglobin
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d5azqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5azqa_ a.1.1.2 (A:) Myoglobin {Horse (Equus caballus) [TaxId: 9796]}
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfqg

SCOPe Domain Coordinates for d5azqa_:

Click to download the PDB-style file with coordinates for d5azqa_.
(The format of our PDB-style files is described here.)

Timeline for d5azqa_: