SCOPe 2.06: Domain d5aapa_: 5aap A:

Lineage for d5aapa_ (5aap A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.2: Pilus subunits [49405] (10 proteins)

6. Protein automated matches [190569] (10 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [269237] (20 PDB entries)

8. Domain d5aapa_: 5aap A: [312583]
   automated match to d4csta_
   complexed with edo, gol, vny

Details for d5aapa_

PDB Entry: 5aap, 1.3 Å

PDB Description: complex of the fimh lectin with a c-linked para-biphenyl methylene alpha-d-mannoside

PDB Compounds: (A:) FimH

SCOPe Domain Sequences for d5aapa_:

Sequence; same for both SEQRES and ATOM records:

>d5aapa_ b.2.3.2 (A:) automated matches {Escherichia coli [TaxId: 83333]}
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

Timeline for d5aapa_:

• d5aapa_ is new in SCOPe 2.06-stable
  
• d5aapa_ appears in SCOPe 2.07
  
• d5aapa_ appears in the current release, SCOPe 2.08