| Class b: All beta proteins [48724] (180 folds) |
| Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.3: Bacterial adhesins [49401] (7 families) ![]() |
| Family b.2.3.2: Pilus subunits [49405] (11 proteins) |
| Protein automated matches [190569] (9 species) not a true protein |
| Species Escherichia coli [TaxId:83333] [269237] (7 PDB entries) |
| Domain d5aapa_: 5aap A: [312583] automated match to d4csta_ complexed with edo, gol, vny |
PDB Entry: 5aap (more details), 1.3 Å
SCOPe Domain Sequences for d5aapa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5aapa_ b.2.3.2 (A:) automated matches {Escherichia coli [TaxId: 83333]}
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt
Timeline for d5aapa_: