Lineage for d5ayjc2 (5ayj C:159-314)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2207295Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 2207296Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 2207550Family d.96.1.4: Urate oxidase (uricase) [55633] (2 proteins)
    automatically mapped to Pfam PF01014
  6. 2207765Protein automated matches [254656] (4 species)
    not a true protein
  7. 2207842Species Bacillus sp. [TaxId:36824] [312567] (1 PDB entry)
  8. 2207848Domain d5ayjc2: 5ayj C:159-314 [312581]
    automated match to d1j2ga2
    complexed with mua, p6g, so4; mutant

Details for d5ayjc2

PDB Entry: 5ayj (more details), 2.05 Å

PDB Description: hyperthermostable mutant of bacillus sp. tb-90 urate oxidase - r298c
PDB Compounds: (C:) Uric acid degradation bifunctional protein

SCOPe Domain Sequences for d5ayjc2:

Sequence, based on SEQRES records: (download)

>d5ayjc2 d.96.1.4 (C:159-314) automated matches {Bacillus sp. [TaxId: 36824]}
dntlniteqqsglaglqlikvsgnsfvgfirdeyttlpedsnrplfvylnikwkyknted
sfgtnpenyvaaeqirdiatsvfhetetlsiqhliyligrrilerfpqlqevyfesqnht
wdkiveeipesegkvytepcppygfqcftvtqedlp

Sequence, based on observed residues (ATOM records): (download)

>d5ayjc2 d.96.1.4 (C:159-314) automated matches {Bacillus sp. [TaxId: 36824]}
dntlniteqqsglaglqlikvsgnsfvgfirdeyttlpedsnrplfvylnikwkyknted
sfgtnpenyvaaeqirdiatsvfhetetlsiqhliyligrrilerfpqlqevyfesqnht
wdkiveeiegkvytepcppygfqcftvtqedlp

SCOPe Domain Coordinates for d5ayjc2:

Click to download the PDB-style file with coordinates for d5ayjc2.
(The format of our PDB-style files is described here.)

Timeline for d5ayjc2: