SCOPe 2.08: Domain d5ayjc2: 5ayj C:159-314

Lineage for d5ayjc2 (5ayj C:159-314)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.96: T-fold [55619] (2 superfamilies)
   beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
   tunnel-shaped: its known members form wide oligomeric barrels different sizes

4. Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families)
   bind purine or pterin in topologically similar sites between subunits

5. Family d.96.1.4: Urate oxidase (uricase) [55633] (2 proteins)
   automatically mapped to Pfam PF01014

6. Protein automated matches [254656] (4 species)
   not a true protein

7. Species Bacillus sp. [TaxId:36824] [312567] (12 PDB entries)

8. Domain d5ayjc2: 5ayj C:159-314 [312581]
   automated match to d1j2ga2
   complexed with mua, p6g, so4; mutant

Details for d5ayjc2

PDB Entry: 5ayj, 2.05 Å

PDB Description: hyperthermostable mutant of bacillus sp. tb-90 urate oxidase - r298c

PDB Compounds: (C:) Uric acid degradation bifunctional protein

SCOPe Domain Sequences for d5ayjc2:

Sequence, based on SEQRES records:

>d5ayjc2 d.96.1.4 (C:159-314) automated matches {Bacillus sp. [TaxId: 36824]}
dntlniteqqsglaglqlikvsgnsfvgfirdeyttlpedsnrplfvylnikwkyknted
sfgtnpenyvaaeqirdiatsvfhetetlsiqhliyligrrilerfpqlqevyfesqnht
wdkiveeipesegkvytepcppygfqcftvtqedlp

Sequence, based on observed residues (ATOM records):

>d5ayjc2 d.96.1.4 (C:159-314) automated matches {Bacillus sp. [TaxId: 36824]}
dntlniteqqsglaglqlikvsgnsfvgfirdeyttlpedsnrplfvylnikwkyknted
sfgtnpenyvaaeqirdiatsvfhetetlsiqhliyligrrilerfpqlqevyfesqnht
wdkiveeiegkvytepcppygfqcftvtqedlp

Timeline for d5ayjc2:

• d5ayjc2 first appeared in SCOPe 2.06
  
• d5ayjc2 appears in SCOPe 2.07