Lineage for d5b0zg_ (5b0z G:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1987252Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1987253Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1987254Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1987741Protein automated matches [193445] (6 species)
    not a true protein
  7. 1987786Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225310] (17 PDB entries)
  8. 1987796Domain d5b0zg_: 5b0z G: [312575]
    Other proteins in same PDB: d5b0zb_, d5b0zf_
    automated match to d2pyoc_
    complexed with cl, mn

Details for d5b0zg_

PDB Entry: 5b0z (more details), 1.99 Å

PDB Description: the crystal structure of the nucleosome containing h3.2, at 1.98 a resolution
PDB Compounds: (G:) Histone H2A type 1-B/E

SCOPe Domain Sequences for d5b0zg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b0zg_ a.22.1.1 (G:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
ktrssraglqfpvgrvhrllrkgnyservgagapvylaavleyltaeilelagnaardnk
ktriiprhlqlairndeelnkllgrvtiaqggvlpniqavllpk

SCOPe Domain Coordinates for d5b0zg_:

Click to download the PDB-style file with coordinates for d5b0zg_.
(The format of our PDB-style files is described here.)

Timeline for d5b0zg_: