Lineage for d5apsa_ (5aps A:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3040541Superfamily h.1.26: Myosin rod fragments [90257] (2 families) (S)
  5. 3040559Family h.1.26.0: automated matches [312570] (1 protein)
    not a true family
  6. 3040560Protein automated matches [312571] (1 species)
    not a true protein
  7. 3040561Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [312572] (2 PDB entries)
  8. 3040562Domain d5apsa_: 5aps A: [312573]
    automated match to d3basa_

Details for d5apsa_

PDB Entry: 5aps (more details), 1.37 Å

PDB Description: sequence ienkkad inserted between gcn4 adaptors - structure a7
PDB Compounds: (A:) General control protein GCN4

SCOPe Domain Sequences for d5apsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5apsa_ h.1.26.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
edkveellskvyhlenevarlkklienkkadmkqledkveellskvyhlenevarlkklv
ger

SCOPe Domain Coordinates for d5apsa_:

Click to download the PDB-style file with coordinates for d5apsa_.
(The format of our PDB-style files is described here.)

Timeline for d5apsa_: