| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.26: Myosin rod fragments [90257] (2 families) ![]() |
| Family h.1.26.0: automated matches [312570] (1 protein) not a true family |
| Protein automated matches [312571] (1 species) not a true protein |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [312572] (2 PDB entries) |
| Domain d5apsa_: 5aps A: [312573] automated match to d3basa_ |
PDB Entry: 5aps (more details), 1.37 Å
SCOPe Domain Sequences for d5apsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5apsa_ h.1.26.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
edkveellskvyhlenevarlkklienkkadmkqledkveellskvyhlenevarlkklv
ger
Timeline for d5apsa_: