SCOPe 2.08: Domain d5afda1: 5afd A:1-297

Lineage for d5afda1 (5afd A:1-297)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.0: automated matches [191319] (1 protein)
   not a true family

6. Protein automated matches [190115] (94 species)
   not a true protein

7. Species Aliivibrio salmonicida [TaxId:316275] [312556] (1 PDB entry)

8. Domain d5afda1: 5afd A:1-297 [312557]
   Other proteins in same PDB: d5afda2
   automated match to d3e96b_
   complexed with edo, gol

Details for d5afda1

PDB Entry: 5afd, 1.65 Å

PDB Description: native structure of n-acetylneuramininate lyase (sialic acid aldolase) from aliivibrio salmonicida

PDB Compounds: (A:) n-acetylneuraminate lyase

SCOPe Domain Sequences for d5afda1:

Sequence; same for both SEQRES and ATOM records:

>d5afda1 c.1.10.0 (A:1-297) automated matches {Aliivibrio salmonicida [TaxId: 316275]}
mkkltgliaaphtpfdsssnvnfeeidkiakhlindgvkgiyvcgttgegihcsveerka
iaerwvsacnhkldiivhtgalsivdtleltrhadtldilatsaigpcffkpgsvsdlve
ycatiaaaapskgfyyyhsgmsgvnlnmeefliqadkripnlsglkfnsgdlyeyqrclr
acdgkfdvpfgvdeflpgalavgaksavgstynyaaphfnsiieafnkgdhdavfnkmtn
vielirvlvefggvaagkiamelhdinagdprlplmplsaeqkltvvekmraanflk

Timeline for d5afda1:

• d5afda1 first appeared in SCOPe 2.06
  
• d5afda1 appears in SCOPe 2.07