Lineage for d5afda1 (5afd A:1-297)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2835965Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2835966Protein automated matches [190115] (94 species)
    not a true protein
  7. 2836029Species Aliivibrio salmonicida [TaxId:316275] [312556] (1 PDB entry)
  8. 2836030Domain d5afda1: 5afd A:1-297 [312557]
    Other proteins in same PDB: d5afda2
    automated match to d3e96b_
    complexed with edo, gol

Details for d5afda1

PDB Entry: 5afd (more details), 1.65 Å

PDB Description: native structure of n-acetylneuramininate lyase (sialic acid aldolase) from aliivibrio salmonicida
PDB Compounds: (A:) n-acetylneuraminate lyase

SCOPe Domain Sequences for d5afda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5afda1 c.1.10.0 (A:1-297) automated matches {Aliivibrio salmonicida [TaxId: 316275]}
mkkltgliaaphtpfdsssnvnfeeidkiakhlindgvkgiyvcgttgegihcsveerka
iaerwvsacnhkldiivhtgalsivdtleltrhadtldilatsaigpcffkpgsvsdlve
ycatiaaaapskgfyyyhsgmsgvnlnmeefliqadkripnlsglkfnsgdlyeyqrclr
acdgkfdvpfgvdeflpgalavgaksavgstynyaaphfnsiieafnkgdhdavfnkmtn
vielirvlvefggvaagkiamelhdinagdprlplmplsaeqkltvvekmraanflk

SCOPe Domain Coordinates for d5afda1:

Click to download the PDB-style file with coordinates for d5afda1.
(The format of our PDB-style files is described here.)

Timeline for d5afda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5afda2