Lineage for d4reqa2 (4req A:561-728)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21773Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
  4. 22041Superfamily c.23.6: Cobalamin (vitamin B12)-binding domain [52242] (1 family) (S)
  5. 22042Family c.23.6.1: Cobalamin (vitamin B12)-binding domain [52243] (3 proteins)
  6. 22056Protein Methylmalonyl-CoA mutase C-terminal domains of alpha and beta subunits [52249] (1 species)
  7. 22057Species Propionibacterium freudenreichii, subsp. shermanii [TaxId:1744] [52250] (8 PDB entries)
  8. 22070Domain d4reqa2: 4req A:561-728 [31255]
    Other proteins in same PDB: d4reqa1, d4reqb1, d4reqc1, d4reqd1

Details for d4reqa2

PDB Entry: 4req (more details), 2.2 Å

PDB Description: Methylmalonyl-COA Mutase substrate complex

SCOP Domain Sequences for d4reqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4reqa2 c.23.6.1 (A:561-728) Methylmalonyl-CoA mutase C-terminal domains of alpha and beta subunits {Propionibacterium freudenreichii, subsp. shermanii}
aqirtisgvyskevkntpeveearelveefeqaegrrprillakmgqdghdrgqkviata
yadlgfdvdvgplfqtpeetarqaveadvhvvgvsslagghltlvpalrkeldklgrpdi
litvggvipeqdfdelrkdgaveiytpgtvipesaislvkklraslda

SCOP Domain Coordinates for d4reqa2:

Click to download the PDB-style file with coordinates for d4reqa2.
(The format of our PDB-style files is described here.)

Timeline for d4reqa2: