Lineage for d5arkb_ (5ark B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2535185Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 2535186Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 2535187Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 2535659Protein automated matches [190061] (7 species)
    not a true protein
  7. 2535812Species Pig (Sus scrofa) [TaxId:9823] [312520] (3 PDB entries)
  8. 2535814Domain d5arkb_: 5ark B: [312523]
    automated match to d2rnfa_
    protein/RNA complex; complexed with po4, ump

Details for d5arkb_

PDB Entry: 5ark (more details), 2.28 Å

PDB Description: crystal structure of porcine rnase 4 in complex with dump
PDB Compounds: (B:) ribonuclease 4

SCOPe Domain Sequences for d5arkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5arkb_ d.5.1.1 (B:) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
qdrmyqrflrqhvdpdatggndaycnlmmqrrkmtshyckrfntfihediwnirsicsts
niqckngqmnchegvvkvtdcretgssrapncryramastrrvviacegnpevpvhfdk

SCOPe Domain Coordinates for d5arkb_:

Click to download the PDB-style file with coordinates for d5arkb_.
(The format of our PDB-style files is described here.)

Timeline for d5arkb_: