Lineage for d5aewj_ (5aew J:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2180921Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2181455Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2181740Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins)
    Pfam PF00866
  6. 2181796Protein automated matches [190223] (5 species)
    not a true protein
  7. 2181797Species Burkholderia xenovorans [TaxId:266265] [189543] (9 PDB entries)
  8. 2181832Domain d5aewj_: 5aew J: [312513]
    Other proteins in same PDB: d5aewa1, d5aewa2, d5aewc1, d5aewc2, d5aewe1, d5aewe2, d5aewg1, d5aewg2, d5aewi1, d5aewi2, d5aewk1, d5aewk2, d5aewm1, d5aewm2, d5aewo1, d5aewo2, d5aewq1, d5aewq2, d5aews1, d5aews2, d5aewu1, d5aewu2, d5aeww1, d5aeww2
    automated match to d2xsob_
    complexed with bnl, fe2, fes

Details for d5aewj_

PDB Entry: 5aew (more details), 1.88 Å

PDB Description: crystal structure of ii9 variant of biphenyl dioxygenase from burkholderia xenovorans lb400 in complex with biphenyl
PDB Compounds: (J:) Biphenyl dioxygenase subunit beta

SCOPe Domain Sequences for d5aewj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5aewj_ d.17.4.4 (J:) automated matches {Burkholderia xenovorans [TaxId: 266265]}
wpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmplrtnrmiregeley
sgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivketatpdtfevnsa
filyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastllsnnlsmff

SCOPe Domain Coordinates for d5aewj_:

Click to download the PDB-style file with coordinates for d5aewj_.
(The format of our PDB-style files is described here.)

Timeline for d5aewj_: