Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) has a beta-alpha(2)-beta insertion after the main helix |
Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins) Pfam PF00866 |
Protein automated matches [190223] (5 species) not a true protein |
Species Burkholderia xenovorans [TaxId:266265] [189543] (9 PDB entries) |
Domain d5aewj_: 5aew J: [312513] Other proteins in same PDB: d5aewa1, d5aewa2, d5aewc1, d5aewc2, d5aewe1, d5aewe2, d5aewg1, d5aewg2, d5aewi1, d5aewi2, d5aewk1, d5aewk2, d5aewm1, d5aewm2, d5aewo1, d5aewo2, d5aewq1, d5aewq2, d5aews1, d5aews2, d5aewu1, d5aewu2, d5aeww1, d5aeww2 automated match to d2xsob_ complexed with bnl, fe2, fes |
PDB Entry: 5aew (more details), 1.88 Å
SCOPe Domain Sequences for d5aewj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5aewj_ d.17.4.4 (J:) automated matches {Burkholderia xenovorans [TaxId: 266265]} wpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmplrtnrmiregeley sgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivketatpdtfevnsa filyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastllsnnlsmff
Timeline for d5aewj_:
View in 3D Domains from other chains: (mouse over for more information) d5aewa1, d5aewa2, d5aewb_, d5aewc1, d5aewc2, d5aewd_, d5aewe1, d5aewe2, d5aewf_, d5aewg1, d5aewg2, d5aewh_, d5aewi1, d5aewi2, d5aewk1, d5aewk2, d5aewl_, d5aewm1, d5aewm2, d5aewn_, d5aewo1, d5aewo2, d5aewp_, d5aewq1, d5aewq2, d5aewr_, d5aews1, d5aews2, d5aewt_, d5aewu1, d5aewu2, d5aewv_, d5aeww1, d5aeww2, d5aewx_ |